Search results for "Acute [MeSH]"

showing 10 items of 350 documents

Leukemic Colony-Forming Cells in Acute Myeloblastic Leukemia: Maturation Hierarchy and Growth Conditions

1987

Despite their primitive morphological appearance, the majority of leukemic blasts in acute myeloblastic leukemia (AML) are end-stage, nonproliferating cells. Only a small subset of AML blasts are capable of a sufficient number of divisions to form colonies in semisolid medium [1, 2]. It has been suggested that these leukemic colony-forming cells (L-CFC) may act in vivo as progenitor cells to maintain the rest of the leukemic cell population [3, 4]. L-CFC share several properties with normal myeloid progenitor cells, including self-renewal potential and high thymidine suicide index [2, 3]. As in the case of normal myeloid progenitor cells (NMPC), colony growth of L-CFC from most patients req…

education.field_of_studyAcute myeloblastic leukemiaPopulationCellPlacental tissueBiologymedicine.diseasechemistry.chemical_compoundmedicine.anatomical_structurechemistryIn vivoCancer researchmedicineProgenitor celleducationThymidineLeukemic Blasts
researchProduct

Ansiedad social subclínica en adultos jóvenes sanos: cortisol y ansiedad subjetiva en respuesta a estrés agudo

2021

No existe consenso sobre el patrón de liberación de cortisol y su relación con la ansiedad subjetiva en situaciones de estrés en población con ansiedad social. Nuestro objetivo fue determinar la respuesta de cortisol y ansiedad subjetiva en individuos con ansiedad social sometidos a un estresor psicosocial agudo. 26 universitarios (58.6% hombres), edad media = 21.62 ± 0.43, fueron expuestos a la versión estrés o control del Maastricht Acute Stress Test. El cortisol salival y la ansiedad subjetiva fueron medidos antes, durante y post-estrés. Los participantes mostraron un incremento en los niveles de cortisol durante las fases de estrés y post-estrés, con una respuesta significativamente may…

education.field_of_studySocial anxietyStressorPopulationmedicineAnxietyYoung adultAcute stressmedicine.symptomPsychologyeducationPsychosocialGeneral PsychologySubclinical infectionClinical psychologyAnales de Psicología
researchProduct

Causal and Non-Causal Frequency Domain Assessment of Spontaneous Baroreflex Sensitivity after Myocardial Infarction

2020

Acute myocardial infarction (AMI) is thought to alter the baroreflex control of arterial pressure. We tested this hypothesis investigating the changes of the cardiovascular response after AMI in comparison with young and old healthy controls studied at rest and during head-up tilt, using causal and non-causal frequency domain measures of the baroreflex sensitivity. Our results indicate: (i) the importance of using a causal approach that takes into account not only feedback but also feedforward effects in the study of interactions between the heart period and the arterial pressure; (ii) the compromised capacity of baroreceptors to control SAP fluctuations in post-AMI patients, both at rest a…

electrocardiography (ECG)medicine.medical_specialtyBaroreceptorGain measurementbusiness.industrymusculoskeletal neural and ocular physiologyPostural stresssystolic arterial pressure (SAP)Baroreflexmedicine.diseaseAcute myocardial infarction (AMI)Blood pressurebaroreflex sensitivity (BRS)Frequency domainInternal medicineSettore ING-INF/06 - Bioingegneria Elettronica E InformaticamedicineCardiologycardiovascular diseasesMyocardial infarctionSensitivity (control systems)business
researchProduct

Extracellular vesicles and high‐density lipoproteins: Exercise and oestrogen‐responsive small RNA carriers

2023

Decreased systemic oestrogen levels (i.e., menopause) affect metabolic health. However, the detailed mechanisms underlying this process remain unclear. Both oestrogens and exercise have been shown to improve metabolic health, which may be partly mediated by circulating microRNA (c-miR) signalling. In recent years, extracellular vesicles (EV) have increased interest in the field of tissue crosstalk. However, in many studies on EV-carried miRs, the co-isolation of high-density lipoprotein (HDL) particles with EVs has not been considered, potentially affecting the results. Here, we demonstrate that EV and HDL particles have distinct small RNA (sRNA) content, including both host and nonhost sRN…

estrogeenitextracellular RNA-carriershormonal therapyHistologyvaihdevuodetkuntoliikuntaphysical activityCell Biologyregulatory RNAacute exercisepostmenopausepeakoxygen uptakehormonihoitotasannevuodetoestrogen deficiencymetabolismaineenvaihduntafyysinen aktiivisuusJournal of Extracellular Vesicles
researchProduct

Role of gene polymorphisms IL 10 (-1082 G/A) and TNFa (-308G/A) in susceptibility to acute myocardial infarction in young man.

2011

gene polymorphisms IL10 (-1082 G/A) and TNF a (-308G/A)acute myocardial infarctionSettore MED/05 - Patologia Clinicayoung man.
researchProduct

Acute Mesenteric Ischemia in COVID-19 Patients.

2022

Acute mesenteric ischemia is a rare but extremely severe complication of SARS-CoV-2 infection. The present review aims to document the clinical, laboratory, and imaging findings, management, and outcomes of acute intestinal ischemia in COVID-19 patients. A comprehensive search was performed on PubMed and Web of Science with the terms “COVID-19” and “bowel ischemia” OR “intestinal ischemia” OR “mesenteric ischemia” OR “mesenteric thrombosis”. After duplication removal, a total of 36 articles were included, reporting data on a total of 89 patients, 63 being hospitalized at the moment of onset. Elevated D-dimers, leukocytosis, and C reactive protein (CRP) were present in most reported cases, a…

hypercoagulabilitySARS-CoV-2RthromboemboembolismMedicineCOVID-19General MedicineReviewendothelitisacute mesenteric ischemiacytokinesJournal of clinical medicine
researchProduct

IN-HOSPITAL COMPLICATIONS OF ACUTE MYOCARDIAL INFARCTION IN HYPERTENSIVE SUBJECTS

2005

BACKGROUND: Recent studies have shown a worse in-hospital outcome in hypertensive than in normotensive patients with acute myocardial infarction (AMI), which has been attributed to more frequent complications. The aim of this study was to investigate clinical patterns, risk factors, and in-hospital complications in hypertensive and normotensive patients with AMI. METHODS: Of 4994 consecutive patients with AMI admitted to the intensive care unit, hypertensive patients with first infarction (n = 915; mean age 68.8 +/- 11.4 years) and 915 gender- and age-matched normotensive subjects were retrospectively studied. RESULTS: In the univariate analysis, hypertensive subjects presented more frequen…

hypertension myocardial infaction compllicationsacute myocardial infarction
researchProduct

Cost effectiveness of zofenopril in patients with left ventricular systolic dysfunction after acute myocardial infarction: a post- hoc analysis of th…

2013

BACKGROUND: In SMILE-4 (the Survival of Myocardial Infarction Long-term Evaluation 4 study), zofenopril + acetylsalicylic acid (ASA) was superior to ramipril + ASA in reducing the occurrence of major cardiovascular events in patients with left ventricular dysfunction following acute myocardial infarction. The present post hoc analysis was performed to compare the cost-effectiveness of zofenopril and ramipril. METHODS: In total, 771 patients with left ventricular dysfunction and acute myocardial infarction were randomized in a double-blind manner to receive zofenopril 60 mg/day (n = 389) or ramipril 10 mg/day (n = 382) + ASA 100 mg/day and were followed up for one year. The primary study end…

left ventricular dysfunctionmedicine.medical_specialtybusiness.industryCost effectivenessHealth PolicyPublic Health Environmental and Occupational HealthElectrocardiography in myocardial infarctionacute myocardial infarctioncost-effectiveneramiprilacetylsalicylic acidmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareZofenoprilchemistry.chemical_compoundangiotensin-converting enzyme inhibitorchemistryInternal medicinePost-hoc analysismedicineCardiologyIn patientzofenoprilMyocardial infarctionbusinessValue in Health
researchProduct

Variations in plasma lipids and in the LDL peak particle size after acute myocardial infarction

2002

lipids LDL acute myocardial infarction
researchProduct

Essential Oil Composition of Alluaudia procera and in Vitro Biological Activity on Two Drug-Resistant Models

2019

Drug resistance is a major obstacle in antibiotic and antitumor chemotherapy. In response to the necessity to find new therapeutic strategies, plant secondary metabolites including essential oils (EOs) may represent one of the best sources. EOs in plants act as constitutive defenses against biotic and abiotic stress, and they play an important role in the pharmacology for their low toxicity, good pharmacokinetic and multitarget activity. In this context, natural products such as EOs are one of the most important sources of drugs used in pharmaceutical therapeutics. The aim of this paper was to identify the chemical composition of the essential oil of Alluaudia procera leaves, obtained by hy…

medicine.drug_classAntibioticsPharmaceutical ScienceContext (language use)Drug resistancePharmacologyBiologymedicine.disease_causeSettore BIO/19 - Microbiologia Generaleessential oilAnalytical Chemistrylaw.inventionDidiereaceaelcsh:QD241-44103 medical and health scienceslcsh:Organic chemistryPharmacokineticslawDrug DiscoverymedicineSettore BIO/15 - Biologia FarmaceuticaPhysical and Theoretical ChemistryEssential oilacute myeloid leukemia cell030304 developmental biology0303 health sciences030306 microbiologyAbiotic stressOrganic ChemistryBiological activitySettore CHIM/06 - Chimica Organicasucculent plantsChemistry (miscellaneous)Staphylococcus aureusSettore BIO/03 - Botanica Ambientale E ApplicataSettore BIO/14 - FarmacologiaMolecular MedicineMolecules
researchProduct